PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010546706.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 1055aa    MW: 117163 Da    PI: 9.3088
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010546706.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.41.4e-074480340
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40
                      WT+ E e+++da +++G + W+++a+ + ++R+ +++
   XP_010546706.1 44 QWTKGELERFYDAYRKHGLD-WRKVAAAVRNNRSVEMV 80
                     6*****************99.*********99998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-74389IPR009057Homeodomain-like
PfamPF002496.8E-64480IPR001005SANT/Myb domain
CDDcd001675.65E-44590No hitNo description
PfamPF065843.4E-30631732IPR033471DIRP domain
SMARTSM011356.0E-52631733IPR033471DIRP domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1055 aa     Download sequence    Send to blast
MAPSRKSRSV NKRFSNEASP EKDVGNSSKS KQMKKKLSDN LGPQWTKGEL ERFYDAYRKH  60
GLDWRKVAAA VRNNRSVEMV EALFCMNRAY LSLPEGTASV AGLIAMMTDH YSVMDGSDSE  120
AEGHDASGVP RKYQKRKHAH VQFSESREEA NPSHSFASTD GCLLFLKEAQ DYGSWRRATG  180
KRTPRFPVPR SYRRDDREGS TPPSKRARKL VDNDDVAHLF ALTLTEASKR GGSEPPYRRT  240
EHSDSSPIKS LGETSQAREA QSKLRGCSKY EEWVEGNREK KHETGVSDRD ATSFMDMEVV  300
GTLEALQGGK NVKAEEVEGN DCDEKGEACS ASEELRSKSQ QGKVDVEGPR GKYSPRCLKK  360
RNKKLHSKDE FEALQALLKL STSTFPVALM ESESAARIKD ERTANNMDEK SSAPEATSTS  420
PLGRKSTQDG AEENALNAIS AVENTNYRKP KSLRQASADG SAGPAGNQQQ QPTSGTSRRR  480
RKPKVLDAEP PKNSNQNKST LVEESVREEN AKSVVRTKRS GQAPAEGKQL KTAKTLEESS  540
PAGDKKRPDA GVTMSTIPVS ASGPATLPQK PPNRRKVNLK KMLQERVKFS ETTSKAPHSD  600
ESLSEHELLQ EKLSTCLSNP LARRRCIFEW FYSAIDYLWF TKMEFMDYLN HVGLGHIPRL  660
ARFEWNVIKS SLGRPRRFSE RFLQEERDKL QHYRETVRKH YTDLRAGVTR EGLPADLARP  720
LSVGNKVIAI HPKTREIQCG KILTVDHNKC SVLFDRDDLG AEFVMDIDCM PSNPLEYMPE  780
GLRRHISKGL PISKEAQLNR HPNSGGSVML PSNGLENATF SMNPPLQQGD TNGQILLGKI  840
STTNPTTVQQ ATNNQPYTTT CRKAKELVIQ QALAMQHTSI EKEKEPEMLE IFKGSKSRAQ  900
AMVDAAVKAA CSVIEGEDKG KKIQEAIDSM GKHQPLPGSM VPGVKHQEHA NGSLDHLSQS  960
PSETSPPLVN GSISQNGSEK NEDQMPSELI SSCVATWLMI QTCTERQYPP ADVAQLIDTA  1020
VTSLHPKCPQ NLPIYREIQT CMGRIKTQIL ALVPT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010546706.10.0PREDICTED: protein ALWAYS EARLY 2-like
SwissprotQ6A3330.0ALY2_ARATH; Protein ALWAYS EARLY 2
TrEMBLR0HJB20.0R0HJB2_9BRAS; Uncharacterized protein
STRINGAT3G05380.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29622241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21430.21e-127DNA binding